PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.110080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 494aa    MW: 55629.7 Da    PI: 8.9676
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.110080.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1001.6e-31355410156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W++eLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQk+Rl+
  Cucsa.110080.1 355 KQRRCWSKELHRRFVSALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKFRLH 410
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.152352412IPR017930Myb domain
SuperFamilySSF466893.58E-17352413IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-28353413IPR009057Homeodomain-like
TIGRFAMsTIGR015576.3E-26355410IPR006447Myb domain, plants
PfamPF002492.3E-6357407IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 494 aa     Download sequence    Send to blast
MFSLPLALRS ESPFSTYNPN PTIFLLSPLT PFSLFSLPVF IRNLINSTSS RIYIYIYIDL  60
YIFLFYLYVS PTFITLLFLP FFLLTFDPKI QTKIWVLSTT RRSIMGSLPS ELTLDFRPSF  120
VPKTITDFFK EVSMIGNVSD RVSKLNDFIK TLEDEVRKID AFKRELPLCM VLLKDAILAV  180
KDEKMQCAVP KTKPVLEEFI PLKKEQEEDD GDDSKKGNDY RDQKNWMSSV QLWNSDDNHH  240
SNYKLETKRN EKGGPVVTQV SMQSCRTKNG ERIQVPFKPS YPIFSSAMVA RKEDKEEFPI  300
HGLSLCTPGI KSPMEESAST GSRSSGTRAV SSSTLTASVN LRTGMQQQKQ QCSRKQRRCW  360
SKELHRRFVS ALQQLGGSQV ATPKQIRELM QVDGLTNDEV KSHLQKFRLH ARRLPASAVP  420
PANQSSVVVL GGLLVPQDPY ADSSKACSSQ SGSPQGPLQL AGTGGDSMEE EEDVKSESYC  480
WKSRIQKPGN EDV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819140.0LN681914.1 Cucumis melo genomic scaffold, anchoredscaffold00050.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011649201.10.0PREDICTED: uncharacterized protein LOC101214647
TrEMBLA0A0A0LIJ10.0A0A0A0LIJ1_CUCSA; Uncharacterized protein
STRINGVIT_03s0063g01060.t011e-150(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.12e-44G2-like family protein